PAK1, kinase domain(recombinant human PAK1 kinjase domain)

SKU
P-1645
  • MW:33,646 Da
Product Name Qty
PAK1, kinase domain(recombinant human PAK1 kinjase domain)
10 ug
$396.45
P21-activated kinase 1, kinase domain, corresponding to 248 545 of full-length human PAK1. Protein Type:Kinase. Source:E. coli. Underlined amino acids (GPHM) are from HRV 3C cleavage site. Phosphorylated at 423. Sequence: GPHMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMREN KNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIA TNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
More Information
SKU
P-1645
Molecular Weight
33,646 Da
Stability
N/A
Storage Temp
-80°C
THERAPEUTIC AREA
Not Available
USE
Not Available
MDL NUMBER
Not Available
CHEMACX
Not Applicable
INCHI
Not Applicable
SMILES
Not Applicable
Peptide sequence
Not Applicable
RTECS
Not Applicable
UN #'S
Not Applicable
PACKING GROUP
Not Applicable
HAZARD CLASS
Not Applicable
Promo text for AGS discount
N/A
UN #'S Not Applicable
Packing Group Not Applicable
To Top