PAK2, kinase domain

SKU
P-1643
Product Name Qty
PAK2, kinase domain
10 ug
$396.45
P21-activated kinase 2, kinase domain, corresponding to 227 - 524 of full-length human PAK2. Protein Type:Kinase Source:E. coli Underlined amino acids (GPM) are from HRV 3C cleavage site. PAK2-KD sequence is 227 - 524 of full-length human PAK2. Phosphorylated on T402 and additional sites. Sequence: GPMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIK QINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTD VVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTD FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEG EPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKEL LQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
More Information
SKU
P-1643
Stability
N/A
Storage Temp
-80°C
THERAPEUTIC AREA
Not Available
USE
Not Available
MDL NUMBER
Not Available
CHEMACX
Not Applicable
PubChecm ID
N/A
INCHI
Not Applicable
SMILES
Not Applicable
Peptide sequence
Not Applicable
RTECS
Not Applicable
UN #'S
Not Applicable
PACKING GROUP
Not Applicable
HAZARD CLASS
Not Applicable
Special Shipping
N/A
E-Guides
N/A
Blog Post
N/A
Citations
N/A
Citations_Hyperlink
N/A
Reference
N/A
Reference Hyperlink
N/A
Additional Images
N/A
Additional Videos
N/A
Hazard Image
N/A
Structure Available (Y/N)
N/A
Promo text for AGS discount
N/A
UN #'S Not Applicable
Packing Group Not Applicable
To Top