Quick Order Pad
Your Shopping Cart is Empty
Hello, Sign In

PAK1, kinase domain(recombinant human PAK1 kinjase domain), 10 UG

Price$ 428.16
  • SKU: P-1645-10UG
  • Pack Size: 10 UG
Quantity
-
+

33,646 Da


P21-activated kinase 1, kinase domain, corresponding to 248 545 of full-length human PAK1. Protein Type:Kinase. Source:E. coli. Underlined amino acids (GPHM) are from HRV 3C cleavage site. Phosphorylated at 423. Sequence: GPHMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMREN KNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIA TNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

0.1 lbs



Research or further manufacturing use only, not for food or drug use.

Product Recommendations