Quick Order Pad
Your Shopping Cart is Empty
Hello, Sign In

PAK2, kinase domain, 10 UG

Price$ 428.16
  • SKU: P-1643-10UG
  • Pack Size: 10 UG
Quantity
-
+

P21-activated kinase 2, kinase domain, corresponding to 227 - 524 of full-length human PAK2. Protein Type:Kinase Source:E. coli Underlined amino acids (GPM) are from HRV 3C cleavage site. PAK2-KD sequence is 227 - 524 of full-length human PAK2. Phosphorylated on T402 and additional sites. Sequence: GPMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIK QINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTD VVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTD FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEG EPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKEL LQHPFLKLAKPLSSLTPLIMAAKEAMKSNR

0.1 lbs



Research or further manufacturing use only, not for food or drug use.

Product Recommendations